PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3443690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 602aa    MW: 66334.1 Da    PI: 8.1157
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3443690.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.93.9e-094074441954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  L+k++gL+ +qV++WF N R +
  Lj1g3v3443690.1 407 FEHflHPYPTDTDKLMLSKQTGLSRSQVSNWFINARVR 444
                      554459******************************98 PP

2BELL100.61.2e-32275343371
             BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                      +e +k k++Ll++l+eV++rYk y++q+++v+ sFe vaglg+a+pY+slA +a+S+hFrcLk+ai+++
  Lj1g3v3443690.1 275 NEGRKNKSRLLTMLDEVYRRYKLYYQQMHAVVTSFEYVAGLGNAAPYASLAVNAMSKHFRCLKNAITDR 343
                      577899************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.6E-43211342IPR006563POX domain
PfamPF075265.6E-37216341IPR006563POX domain
PROSITE profilePS5007111.774385448IPR001356Homeobox domain
SMARTSM003894.5E-10388452IPR001356Homeobox domain
CDDcd000861.61E-12388449No hitNo description
SuperFamilySSF466891.24E-16390455IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-27391452IPR009057Homeodomain-like
PfamPF059202.9E-18405444IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MAEGFEHYHV PQQSRRDKLR VLEPSPILHP LPSSLYDPSL ISSDLLACVN NNQQGHHDVF  60
HGGKATNQGG GGSVKEERSN LMMGFVNSGA GGSSSSSSPP ASVSHHGYLD PFLYPPQNLQ  120
SFREFDYNDG SGIMVFKPEP LSLSLSSHNK NTHHHALELN LDQRYGAIYG DKVGGGGGGG  180
VVPVVVGGGS GGCASNEVSR NSTVVPVRPF TGYSSVLKGS RFLRPAQQLL EDLCDIGVRG  240
VYSEKITADA SLMETPAESL SASGIVVDDS LGDVNEGRKN KSRLLTMLDE VYRRYKLYYQ  300
QMHAVVTSFE YVAGLGNAAP YASLAVNAMS KHFRCLKNAI TDRLQFINKT HFQMSNRKDE  360
SPRFRGSDRG GPYGQRSTGF LEHQQPVWRP QRGLPERAVS VLRAWLFEHF LHPYPTDTDK  420
LMLSKQTGLS RSQVSNWFIN ARVRLWKPMV EEIHMLESQQ SQKTSQREEH SRNNLSDHLL  480
PSDNITENPS TSTHKFRTRD ELPNMPVRSQ EQLNQQTNTS NIQQVGIGGS MGSTGAGNNG  540
VSLTLGLHQN HGIGLSEPFR MSQRFGLALQ PEAVYVTSGF ESHNRHFGRD VIGGQLLHDF  600
VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-16394452563Homeobox protein Meis2
4xrm_B4e-16394452563Homeobox protein Meis2
4xrs_A3e-16394451158Homeobox protein Meis1
4xrs_B3e-16394451158Homeobox protein Meis1
5bng_A3e-16394452159Homeobox protein Meis2
5bng_B3e-16394452159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140461.10.0hypothetical protein PHAVU_008G114300g
SwissprotQ9LZM81e-116BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLV7B4E50.0V7B4E5_PHAVU; Uncharacterized protein
STRINGGLYMA18G41280.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-112TALE family protein